PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_28090
Common NameKK1_030623
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 310aa    MW: 35337.4 Da    PI: 7.2636
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_28090genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.34.3e-19128174148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd  lv++v+++G++ W+ Ia+ ++ gR +kqc++rw+++l
    C.cajan_28090 128 KGQWTEEEDSALVKLVEKFGPKKWSEIAKLLQ-GRIGKQCRERWFNHL 174
                      799*****************************.*************97 PP

2Myb_DNA-binding56.85.3e-18180224147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+WT eEd +l++a+++ G++ W+ Ia++++ gR ++++k++w++ 
    C.cajan_28090 180 KGPWTLEEDIILIEAHHEIGKK-WSEIAKRLP-GRPENSIKNHWNST 224
                      79********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.802123178IPR017930Myb domain
SuperFamilySSF466894.59E-32125221IPR009057Homeodomain-like
SMARTSM007171.3E-16127176IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-27129179IPR009057Homeodomain-like
PfamPF139213.8E-18131189No hitNo description
CDDcd001671.75E-15131174No hitNo description
PROSITE profilePS5129421.7179229IPR017930Myb domain
SMARTSM007172.2E-16179227IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-24180227IPR009057Homeodomain-like
CDDcd001671.95E-11182222No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MSVATQNPAF VMGGPSSTPL YGIPTPSLGD GSSSGGGFVD DYHHHPMMLE QNNNNKMDVL  60
PGHHHKGKDI SDFSQKSMIH PFQASSSMTP SPLFLSNENG LPMSEYQWDI DQRMDKFQND  120
NANDNIIKGQ WTEEEDSALV KLVEKFGPKK WSEIAKLLQG RIGKQCRERW FNHLQPNIKK  180
GPWTLEEDII LIEAHHEIGK KWSEIAKRLP GRPENSIKNH WNSTMRRQNC KRQKNNNDSN  240
YEGSLLHAYV KRVTSIEQAT KVLENNNEEH NKSHDVFNGS TSNYVSMQVN NNNNVDGGNI  300
NCAQYWHMLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-451262282104MYB PROTO-ONCOGENE PROTEIN
1h88_C9e-4512322853158MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-4512322853158MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-451262282104C-Myb DNA-Binding Domain
1msf_C5e-451262282104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006576584.11e-108PREDICTED: uncharacterized protein LOC102665467
TrEMBLA0A151RYP60.0A0A151RYP6_CAJCA; Transcription factor MYB98
STRINGGLYMA03G15870.21e-107(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF143361018
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.11e-47myb domain protein 118